PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00022.1.g04500.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 354aa    MW: 37941.7 Da    PI: 9.0912
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00022.1.g04500.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.7e-32167220255
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Zjn_sc00022.1.g04500.1.sm.mk 167 PRMRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 220
                                   9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-15165221IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-28165220IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-23167221IPR006447Myb domain, plants
PfamPF002491.8E-7168219IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MELFPAHPDL QLQISPPPTT KPMDLGFWKR ALDSTPVATS TAETLATATT PPPSMSIASY  60
APTGVGVGGF HQAAAAGAGH HLGALPFLHH TQPVLLADAS GLRDLATMRP IRGIPVYNTS  120
QPLPFLQSHQ HHHQHCYDAI GHAAGPRLPK AALRLAGAPV KRGARAPRMR WTTSLHARFV  180
HAVELLGGHE RATPKSVLEL MDVKDLTLAH VKSHLQMYRT IKTTDHKPAS ASSYGQAAAK  240
TVIDIPDDNL LDATTNTTSG SESSAQQSNP DGNDHGSSMC ALWSNSSISR GAWFHDKSST  300
RDATPGDIKS LEQDVRSRRR LEDVSDLNSS SPFQTTGMLG SSRKPNLDFT LGPI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0369111e-101BT036911.1 Zea mays full-length cDNA clone ZM_BFb0147F05 mRNA, complete cds.
GenBankKJ7268291e-101KJ726829.1 Zea mays clone pUT3369 G2-like transcription factor (GLK47) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953562.11e-170PREDICTED: probable transcription factor KAN2 isoform X2
TrEMBLW5G9L41e-139W5G9L4_WHEAT; Uncharacterized protein
STRINGSb04g031030.11e-147(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP94383445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17695.11e-44G2-like family protein